HPA018304

Anti-G3BP2 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: G3BP2 Antibody - Anti-G3BP2 antibody produced in rabbit, G3Bp2 Antibody, Anti-G3BP-2, Anti-GAP SH3 domain-binding protein 2, Anti-Ras GTPase-activating protein-binding protein 2
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA018304
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: orthogonal RNAseq; independent; Learn more about Antibody Enhanced Validation
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Sequenza immunogenica: HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE
• N° accesso UniProt: Q9UN86
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... G3BP2(9908)

Descrizione

Descrizione generale

The gene G3BP2 (GAP SH3 domain-binding protein-2) has been mapped to human chromosome 4q21.1. G3BP2 is ubiquitously expressed and is mainly present in the cytoplasm; however, it is capable of shuttling into the nucleus in cell-cycle dependent manner. G3BP2 contains an NTF2 (nuclear transport factor 2)-like domain and two RNA-binding motifs.

Immunogeno

Ras GTPase-activating protein-binding protein 2 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-G3BP2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Azioni biochim/fisiol

G3BP2 (GAP SH3 domain-binding protein-2) is identified as a gene for predicting the presence of lymph node metastasis in primary oral squamous cell carcinoma. G3BP2 is a negative modulator of p53 function. Depletion of G3BP2 leads to up-regulation of p53 and its overexpression leads to the cytoplasmic redistribution of p53. G3BP2 binds mechanomediator TWIST1 (Twist-related protein 1) in the cytoplasm. Loss of G3BP2 leads to nuclear localization of TWIST1 which in response to biomechanical signals induces epithelial-mesenchymal transition, promotes tumor invasion and metastasis. Overexpression of G3BP2 induces formation of cytoplasmic RNA granules called stress granules (SGs). Knockdown of G3BP2 reduce the number of SG-positive cells. During Semliki Forest virus infection, the carboxyl-terminal domain of the viral nonstructural protein 3 forms a complex with G3BP2 and inhibits the formation of SGs on viral mRNAs, thus impairing antiviral defense.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73969

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1