HPA018151

Anti-CDR2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Cerebellar degeneration-related protein 2, Anti-Major Yo paraneoplastic antigen, Anti-Paraneoplastic cerebellar degeneration-associated antigen
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA018151
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: recombinant expression; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:1000-1:2500
• Sequenza immunogenica: GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV
• N° accesso UniProt: Q01850
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CDR2(1039)

Descrizione

Descrizione generale

The gene cerebellar degeneration-related protein-2 (CDR2) has been mapped to human chromosome 16p12.3. The gene encodes a cytoplasmic protein harboring a helix-leucine zipper motif. CDR2 is localized in the cytoplasm.[1][2] The mRNA is ubiquitously expressed in adult mouse tissue with most abundance in the testis. However, the protein is present predominantly in brain, testis, gynecological and breast tumors, suggesting post-transcriptional regulation. CDR2 is cell cycle regulated in tumor cells with highest expression in mitosis.[2]

Immunogeno

Cerebellar degeneration-related protein 2 recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

Cerebellar-degeneration-related antigen-2 (CDR2) is a target antigen in paraneoplastic cerebellar degeneration (PCD).[2] In PCD, CDR2 has been shown to activate specific cytotoxic T lymphocytes which are likely to contribute to the development of autoimmune neuronal degeneration. CDR2 is up-regulated in breast and ovarian tumor cells obtained from the general population of cancer patients. In addition, it is shown to attenuate hypoxia response in renal cell carcinoma by regulating prolyl-4-hydroxylase domain protein abundance. Through its leucine zipper motif CDR2 interacts with c-myc in adult cerebellar Purkinje neurons, tumor cell lines and cerebellar extracts. CDR2 down-regulates c-myc-dependent transcription. The protein is required for mitosis, as CDR2 knockdown cells have aberrant mitotic spindles and impaired proliferation.[2]

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73719

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)