Passa al contenuto
Merck
Tutte le immagini(5)

Documenti fondamentali

HPA012750

Sigma-Aldrich

Anti-HLA-DMA antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-AL662845.5, Anti-HLA class II histocompatibility antigen, DM alpha chain precursor, Anti-MHC class II antigen DMA

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 481.00

CHF 481.00


Spedizione prevista il14 maggio 2025



Scegli un formato

Cambia visualizzazione
100 μL
CHF 481.00

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.43

CHF 481.00


Spedizione prevista il14 maggio 2025


Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

Sequenza immunogenica

PTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEV

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... HLA-DMA(3108)

Descrizione generale

HLA class II histocompatibility antigen, DM α chain (HLA-DMA) is a membrane-anchored heterodimeric protein that belongs to the family of proteins with a major histocompatibility (MHC) fold. It contains a peptide-binding site which is altered to an almost fully closed groove-like structure.

Immunogeno

HLA class II histocompatibility antigen, DM alpha chain precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-HLA-DMA antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

HLA class II histocompatibility antigen, DM α chain (HLA-DMA) is majorly involved in antigen presentation to cluster of differentiation-4 (CD4) T-cells. It catalyzes the release of class II-associated invariant chain-derived peptides (CLIP) from class II histocompatibility molecules which are newly synthesized. It has a peptide exchange activity and functions as a chaperone to peptide-free class II major histocompatibility (MHC) molecules. HLA-DMA binds to class II molecules, like HLA-DR for catalysis and the inhibitor HLA-DO.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71880

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

The structure of HLA-DM, the peptide exchange catalyst that loads antigen onto class II MHC molecules during antigen presentation.
Mosyak L, et al.
Immunity, 9(3), 377-383 (1998)
Enhanced dissociation of HLA-DR-bound peptides in the presence of HLA-DM.
Weber DA, et al.
Science, 274(5287), 618-620 (1996)
Small molecules that enhance the catalytic efficiency of HLA-DM.
Nicholson MJ, et al.
Journal of Immunology, 176(7), 4208-4220 (2006)

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.