Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

HPA011209

Sigma-Aldrich

Anti-FGF4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-FGF-4, Anti-Fibroblast growth factor 4 precursor, Anti-HBGF-4, Anti-HST, Anti-HST-1, Anti-Heparin secretory-transforming protein, Anti-Transforming protein KS3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 556.00

CHF 556.00


Check Cart for Availability


Scegli un formato

Cambia visualizzazione
100 μL
CHF 556.00

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

CHF 556.00


Check Cart for Availability

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

recombinant expression
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

Sequenza immunogenica

VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL

N° accesso UniProt

applicazioni

research pathology

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... FGF4(2249)

Descrizione generale

FGF4 (fibroblast growth factor 4) is a part of FGF family of secreted signaling proteins. FGF family consists of 22 heparin-binding polypeptides. FGF4 conforms in to the β-trefoil fold like other FGF members, and consists of a signal peptide. It was first identified in the screening of Kaposi′s sarcoma and human stomach cancers. This protein is made of 206 amino acids, and contains an N-glycosylation site. This gene is expressed during gastrula and early somite stage embryos, in proximity to the posterior endoderm. In the gut endoderm, it shows an anterior-posterior expression pattern. In adult humans, it is expressed in nervous system, intestines and testis. It is located on human chromosome 11q13.

Immunogeno

Fibroblast growth factor 4 precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Azioni biochim/fisiol

FGF4 (fibroblast growth factor 4) plays an important role in embryogenesis, and is involved in the patterning and survival of embryo. It is responsible for the activation of IIIc splice forms of FGFR1 to 3 by binding to them. Its expression in the initial stages is essential for the successful formation of induced pluripotent stem cells (iPSCs). This is achieved by the interaction of Artd1 (ADP-ribosyltransferase Diphtheria Toxin-like 1) and Sox2 (SRY (sex determining region Y)-box 2), which regulate reprogramming of cells. FGF4 regulates the development of stromal layers in both normal conditions and in acute myeloid leukemia. This gene is involved in spermatogenesis, and is up-regulated in testicular cancers. It has a protective action against adriamycin-induced testicular toxicity.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71534

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Toshiaki Yoshimoto et al.
Anticancer research, 38(1), 501-507 (2017-12-27)
We report the outcomes of sorafenib therapy for advanced hepatocellular carcinoma (HCC) in our Department. Thirty-eight patients with unresectable HCC who were administrated sorafenib from 2009 to 2015 were investigated retrospectively. The 1-year overall survival rate was 59.3%. The macroscopic
Boriana M Zaharieva et al.
The Journal of pathology, 201(4), 603-608 (2003-12-04)
Gene amplification is a common mechanism for oncogene overexpression. High-level amplifications at 11q13 have been repeatedly found in bladder cancer by comparative genomic hybridization (CGH) and other techniques. Putative candidate oncogenes located in this region are CCND1 (PRAD1, bcl-1), EMS1
C J Powers et al.
Endocrine-related cancer, 7(3), 165-197 (2000-10-06)
Fibroblast growth factors (FGFs) are small polypeptide growth factors, all of whom share in common certain structural characteristics, and most of whom bind heparin avidly. Many FGFs contain signal peptides for secretion and are secreted into the extracellular environment, where
Ki-Ryang Koh et al.
Leukemia research, 26(10), 933-938 (2002-08-07)
The hematopoietic supporting abilities are known to be impaired in marrow stromal layers developed from patients with acute myeloid leukemia (AML). In this study, fibroblast growth factor-4 (FGF-4), epidermal growth factor (EGF) or transforming growth factor-beta1 (TGF-beta1) were studied to
Hanako Yamamoto et al.
Oncogene, 21(6), 899-908 (2002-02-13)
We previously demonstrated expression of the HST-1/FGF-4 gene in the testis of normal adult animals, which suggests its possible role in spermatogenesis. For an understanding of its functional significance in the testis, conditional transgene expression was used. Precise genetic switches

Articoli

Glycosaminoglycans are large linear polysaccharides constructed of repeating disaccharide units.

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.