Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

HPA011173

Sigma-Aldrich

Anti-SRPRB antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-Protein APMCF1, Anti-SR-beta, Anti-Signal recognition particle receptor subunit beta

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 556.00

CHF 556.00


Spedizione prevista il28 maggio 2025



Scegli un formato

Cambia visualizzazione
100 μL
CHF 556.00

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

CHF 556.00


Spedizione prevista il28 maggio 2025


Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

tecniche

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Sequenza immunogenica

LCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTL

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SRPRB(58477)

Descrizione generale

SRPRB (signal recognition particle receptor, B subunit) is a member of the small G-protein superfamily, and was first identified in the cDNA library of breast carcinoma MCF-7 cell line. It is also a signal recognition particle receptor β (SRβ), and is made of 271 amino acids. It has a GTPase domain and resides in the cytoplasm. This gene is localized to human chromosome 3q22.2, spans 14.8kb, and contains seven exons and six introns. It has a transmembrane helix, and is expressed ubiquitously.

Immunogeno

Signal recognition particle receptor subunit beta recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Azioni biochim/fisiol

The function of SRPRB (signal recognition particle receptor, B subunit) is not well characterized. Since, it is a G-protein it might be involved in multiple cellular events such as, cell division and differentiation, vesicular transport, nuclear assembly, and modulation of the cytoskeleton. It is a novel gene related to apoptosis, and is over-expressed in colon cancer. It therefore, might play a role in the control of cell cycle. It is also over-expressed in esophagus, lung, breast and liver carcinomas. It might have a role in tumorigenesis. It controls p21 and TIMP3 (TIMP metallopeptidase inhibitor 3) genes, and thus causes cell cycle arrest at the G1 phase in human hepatocellular carcinoma cells (HHCC).

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72051

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Yaqing Zhang et al.
Journal of experimental & clinical cancer research : CR, 28, 111-111 (2009-08-12)
APMCF1 is a novel human gene first cloned from apoptotic MCF-7 cells. Our previous study found ectogenic APMCF1 could induce G1 arrest in hepatocarcinoma cell line HHCC. In order to search its broad expression profile for further understanding of its
Qinlong Li et al.
Molecular biology reports, 33(4), 257-263 (2006-11-03)
We previously found that there was up-regulation of APMCF1 expression in apoptotic MCF-7 cells. Moreover, bioinformatics analysis has found that APMCF1 molecules had similar size and structure with molecules which belong to small G-protein superfamily. We presume that APMCF1 plays
Wei Yan et al.
World journal of gastroenterology, 9(8), 1719-1724 (2003-08-15)
APMCF1 is a novel human gene whose transcripts are up-regulated in apoptotic MCF-7 cells. In order to learn more about this gene's function in other tumors, we cloned its full length cDNA and prepared its polyclonal antibody to investigate its

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.