HPA005768

Anti-ETV4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-E1A-F, Anti-E1AF, Anti-PEA3, ETV4 Antibody - Anti-ETV4 antibody produced in rabbit, Etv4 Antibody
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA005768

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: YLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGV
• N° accesso UniProt: P43268
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ETV4(2118)

Descrizione

Descrizione generale

ETS translocation variant 4 (ETV4) gene is mapped to human chromosome 17q21.31. It is also called Polyoma enhancer activator 3 (PEA3) and it belongs to E26 transformation-specific (ETS) transcription factor family with conserved DNA binding domain (ETS binding domain).

Immunogeno

ETS translocation variant 4 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-ETV4 antibody produced in rabbit has been used in the immunohistochemical analyses.

Azioni biochim/fisiol

ETS translocation variant 4 (ETV4) mediates the transcriptional activation of extracellular signal-regulated kinases or the mitogen-activated protein (ERK MAP) kinase pathway. Sumoylation of ETV4 is implicated in colon cancer cells. ETV4 is oncogenic as it promotes tumor progression. It promotes proliferation in prostate tumor. It also mediates the proliferation and differentiation of embryonic stem cells.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST84717

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)