HPA005716

Anti-SDC4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Amphiglycan antibody produced in rabbit, Anti-Ryudocan core protein antibody produced in rabbit, Anti-SYND4 antibody produced in rabbit, Anti-Syndecan-4 precursor antibody produced in rabbit
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA005716
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: recombinant expression; Learn more about Antibody Enhanced Validation
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200; western blot: 0.04-0.4 μg/mL
• Sequenza immunogenica: PQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEV
• N° accesso UniProt: P31431
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SDC4(6385)

Descrizione

Descrizione generale

Syndecan 4 (SDC4) is a cell surface proteoglycan which binds heparan sulphate. It has membrane-spanning domains, intracellular domains and structurally distinct extracellular domains.

Immunogeno

Syndecan-4 precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

Syndecan 4 (SDC4) acts as a cell surface receptor during cell-cell and cell-matrix interactions. It binds and modifies the action of various growth factors, cytokines, proteases, cell adhesion molecules and extracellular matrix components. SDC4 forms a compact intertwined dimer, stabilized by ionic interactions between peptides at physiological pH with a clamp shape in the central variable V region. It also induces the growth, migration and invasion of hepatoma cells. The association of stromal cell-derived factor 1 (SDF-1), chemokine receptor 4 (CXCR4) and SDC4 induces the growth of human hemochromatotic cell line (Huh7) cells by promoting their entry into the cell cycle. This also inhibits the tumor necrosis factor-α-mediated apoptosis of the cells. During cartilage breakdown in osteoarthritis, it controls the activation of ADAM metallopeptidase with thrombospondin type 1 motif 5 (ADAMTS-5) through direct interaction with the protease and by regulating mitogen-activated protein kinase (MAPK)-dependent synthesis of matrix metalloproteinase-3 (MMP-3).

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85154

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)