HPA004179

Anti-MUC1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-ADMCKD, Anti-ADMCKD1, Anti-CD227, Anti-MCD, Anti-MCKD, Anti-MCKD1, Anti-PEM, Anti-PUM
• Numero MDL: MFCD00213000
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA004179
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunohistochemistry: 1:50- 1:200
• N° accesso UniProt: P15941
• applicazioni: research pathology
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MUC1(4582)

Descrizione

Descrizione generale

MUC1 (Mucin 1) is O-glycosylated, carbohydrate rich, transmembrane glycoprotein. It has approximately 13 members in the family. It is localized on the apical surface of mucosal epithelia in the lung, eye, breast and stomach. It is overexpressed in several epithelial cancers, including pancreatic ductal adenocarcinoma. It is a heterodimer consisting of N-terminal (MUC1-N) and C-terminal (MUC1-C) subunits. N-terminal (MUC1-N) end contains tandem repeats (VNTR) which forms the mucin component.

Mucin 1 is encoded by the gene mapped to human chromosome 1q22.

Immunogeno

mucin 1 isoform 5 precursor recombinant protein epitope signature tag (PrEST)

Sequence
ASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHGVTS

Applicazioni

Anti-MUC1 antibody produced in rabbit has been used in immunohistochemistry.

Azioni biochim/fisiol

MUC1 (Mucin 1) plays a major role in the formation of epithelium lining of the gastrointestinal tract. In gastrointestinal tract, it lubricates to protect the epithelia from oesophagus to the colon. It also lubricates the epithelia of some organs such as pancreas and gall bladder. It participates in the mucosal defensive system by functioning at the mucosal surface. It is directly involved in several signaling pathways as a modulator that affects oncogenesis, motility and metastasis.

Mutated MUC1 gene increases the risk of developing upper gastrointestinal cancers in Caucasian populations.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86683

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)