HPA004114

Anti-MRC1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-C-type lectin domain family 13 member D, Anti-CD206 antigen, Anti-MMR, Anti-Macrophage mannose receptor 1 precursor
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA004114
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: independent; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:1000-1:2500
• Sequenza immunogenica: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
• N° accesso UniProt: P22897
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MRC1(4360)

Descrizione

Descrizione generale

Mannose receptor, C type 1 (MRC1) is a trans-membrane glycoprotein, that is expressed at high levels in the M2 macrophages. This functional gene has 30 exons and is of 101.74 kb. MRC1 consists of a ricin b-type lectin domain (RICIN), a fibronectin type-II domain (FN2), 8 C-type lectin-like domains (CTLDs), a single transmembrane domain (TM) and a short cytosolic domain. It is also expressed on endothelial cells and plasma membrane. This gene is located on human chromosome 10p12.

Immunogeno

Macrophage mannose receptor 1 precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-MRC1 antibody has been used:

• in immunofluorescence Ab staining
• in confocal microscopy
• in immunohistochemical staining

Azioni biochim/fisiol

Mannose receptor, C type 1 (MRC1) encodes for human mannose receptor (MR) and is a member of the C-type lectin receptors family. It recognizes and binds to Mycobacterium tuberculosis by the extracellular structure. It plays a role in antigen-presenting and maintaining a stable internal environment. It plays a critical role in controlling immune response and in regulating allergen induced allergic responses in asthma. This gene along with HSP70 family members through the receptor cytoplasmic tail may contribute to MR trafficking in macrophages.

Mannose receptor, C type 1 (MRC1) is involved in phagocytosis.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86249

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)