AV54369

Anti-NKIRAS2 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-DKFZP434N1526, Anti-KBRAS2, Anti-KappaB-Ras2, Anti-MGC74742, Anti-NFKB inhibitor interacting Ras-like 2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 21 kDa
• Reattività contro le specie: rabbit, bovine, mouse, horse, pig, human, rat, dog
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_060065
• N° accesso UniProt: Q9NYR9
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... NKIRAS2(28511)

Descrizione

Immunogeno

Synthetic peptide directed towards the middle region of human NKIRAS2

Applicazioni

Anti-NKIRAS2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Azioni biochim/fisiol

NKIRAS2 (NFKB inhibitor interacting Ras-like 2) encodes a protein that belongs to Ras family and κB-Ras subfamily. NKIRAS2 interacts with PEST domains of IκBα and IκBβ [inhibitors of the transcription factor nuclear factor κ B (NF-κB)] and decreases their rate of degradation.

Sequenza

Synthetic peptide located within the following region: KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable