AV53656

Anti-LGALS8 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Gal-8, Anti-Lectin, galactoside-binding, soluble, 8 (galectin 8), Anti-PCTA-1, Anti-PCTA1, Anti-Po66-CBP
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 39 kDa
• Reattività contro le specie: dog, human, rabbit, bovine, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_006490
• N° accesso UniProt: O00214
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... LGALS8(3964)

Descrizione

Descrizione generale

LGALS8 (lectin, galactoside-binding, soluble, 8) encodes a protein that belongs to galectin family and is predominantly expressed in tumoral tissues and may be involved in integrin-like cell interactions.

The previously assigned protein identifier Q9BXC8 has been merged into O00214. Full details can be found on the UniProt database.

Immunogeno

Synthetic peptide directed towards the C terminal region of human LGALS8

Applicazioni

Anti-LGALS8 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Azioni biochim/fisiol

Gal-8 activates Rho signaling in TM cells and hence facilitates the regulation of cytoskeletal rearrangement in trabecular meshwork cells. Galectin-8 interacts with integrin and modulates its interaction with the extracellular matrix and hence inhibits cell adhesion and induces apoptosis. Additionally, it also has a role in modulating cell adhesion and cell growth.

Sequenza

Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable