AV50821

Anti-LIN9 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-BARA, Anti-BARPsv, Anti-Lin-9, Anti-Lin-9 homolog (C. elegans), Anti-TGS, Anti-TGS1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 53 kDa
• Reattività contro le specie: guinea pig, horse, mouse, bovine, dog, human, rat, rabbit
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_775106
• N° accesso UniProt: B1B046
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... LIN9(286826)

Descrizione

Immunogeno

Synthetic peptide directed towards the N terminal region of human LIN9

Applicazioni

Anti-LIN9 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Azioni biochim/fisiol

Lin-9 homolog (C. elegans) is a tumor suppressor that associates with retinoblastoma 1 protein and inhibits DNA synthesis and regulates cell cycle and cell cycle-dependent gene expression. LIN9 is a subunit of DREAM complex and regulates gene expression and proliferation of embryonic stem cells.

Sequenza

Synthetic peptide located within the following region: TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable