AV50642

Anti-NRIP3 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-C11orf14, Anti-NY-SAR-105, Anti-Nuclear receptor interacting protein 3
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 27 kDa
• Reattività contro le specie: guinea pig, rabbit, mouse, rat, dog, human, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_065696
• N° accesso UniProt: Q9NQ35
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... NRIP3(56675)

Descrizione

Descrizione generale

NRIP3 codes for nuclear receptor interacting protein 3. It may be involved in pediatric acute myeloid leukemia.
Rabbit Anti-NRIP3 antibody recognizes canine, bovine, human, mouse, and rat NRIP3.

Immunogeno

Synthetic peptide directed towards the middle region of human NRIP3

Applicazioni

Rabbit Anti-NRIP3 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.

Azioni biochim/fisiol

The exact functions of NRIP3 remain unknown.

Sequenza

Synthetic peptide located within the following region: ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEH

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable