Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV50258

Sigma-Aldrich

Anti-B3GALT6 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-β3GalT6, Anti-UDP-Gal:βGal β 1,3-galactosyltransferase polypeptide 6

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 356.00

CHF 356.00


Check Cart for Availability


Scegli un formato

Cambia visualizzazione
100 μL
CHF 356.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 356.00


Check Cart for Availability

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

37 kDa

Reattività contro le specie

human, rat, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

Immunogeno

Synthetic peptide directed towards the N terminal region of human B3GALT6

Applicazioni

Anti-B3GALT6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Azioni biochim/fisiol

UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 (B3GALT6; EDSP2; SEMDJL1) catalyzes the transfer of galactose from UDP-galactose to substrates containing a terminal β-linked galactose moiety. It is localized to Golgi apparatus and is required for glycosaminoglycan synthesis. Aberrations in B3GALT6 gene result in skeletal and connective tissue disorders, collectively known as Ehlers-Danlos syndrome.

Sequenza

Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Masahiro Nakajima et al.
American journal of human genetics, 92(6), 927-934 (2013-05-15)
Proteoglycans (PGs) are a major component of the extracellular matrix in many tissues and function as structural and regulatory molecules. PGs are composed of core proteins and glycosaminoglycan (GAG) side chains. The biosynthesis of GAGs starts with the linker region
Fransiska Malfait et al.
American journal of human genetics, 92(6), 935-945 (2013-05-15)
Proteoglycans are important components of cell plasma membranes and extracellular matrices of connective tissues. They consist of glycosaminoglycan chains attached to a core protein via a tetrasaccharide linkage, whereby the addition of the third residue is catalyzed by galactosyltransferase II
X Bai et al.
The Journal of biological chemistry, 276(51), 48189-48195 (2001-09-12)
A family of five beta1,3-galactosyltransferases has been characterized that catalyze the formation of Galbeta1,3GlcNAcbeta and Galbeta1,3GalNAcbeta linkages present in glycoproteins and glycolipids (beta3GalT1, -2, -3, -4, and -5). We now report a new member of the family (beta3GalT6), involved in

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.