AV49458
Anti-TRPV5 antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-CAT2, Anti-ECAC1, Anti-OTRPC3, Anti-Transient receptor potential cation channel, subfamily V, member 5
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
PM
82 kDa
Reattività contro le specie
human
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... TRPV5(56302)
Descrizione generale
Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) belongs to transient receptor potential (TRP) cation channels family. All TRP channels contain transmembrane helices and CaM (calmodulin) binding sites. TRPV5 is highly expressed in kidney, small intestine and pancreas. Low levels of TRPV5 are observed in testis, prostate, placenta, brain, colon and rectum. TRPV5 has also been reported in human parathyroid glands. The protein mianly localizes at the plasma membrane.
Immunogeno
Synthetic peptide directed towards the N terminal region of human TRPV5
Applicazioni
Anti-TRPV5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Azioni biochim/fisiol
Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) is an epithelial transmembrane calcium-selective channel. TRPV5 mediates renal calcium reabsorption and mutations in this gene result in hypercalciuria. TRPV5 also controls levels of cadmium and zinc in cells. WNK3, the With No Lysine (K) family membre, positively regulate TRPV5.
Sequenza
Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
12 - Non Combustible Liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Laura Giusti et al.
Journal of cellular and molecular medicine, 18(10), 1944-1952 (2014-08-29)
The parathyroid glands play an overall regulatory role in the systemic calcium (Ca(2+)) homeostasis. The purpose of the present study was to demonstrate the presence of the Ca(2+) channels transient receptor potential vanilloid (TRPV) 5 and TRPV6 in human parathyroid
Gergely Kovacs et al.
Cell calcium, 54(4), 276-286 (2013-08-24)
TRPV5 and TRPV6 are two major calcium transport pathways in the human body maintaining calcium homeostasis. TRPV5 is mainly expressed in the distal convoluted and connecting tubule where it is the major, regulated pathway for calcium reabsorption. TRPV6 serves as
Zhaohua Guo et al.
PloS one, 8(2), e58174-e58174 (2013-03-08)
TRPML3 and TRPV5 are members of the mucolipin (TRPML) and TRPV subfamilies of transient receptor potential (TRP) cation channels. Based on sequence similarities of the pore forming regions and on structure-function evidence, we hypothesized that the pore forming domains of
Olena Andrukhova et al.
The EMBO journal, 33(3), 229-246 (2014-01-18)
αKlotho is thought to activate the epithelial calcium channel Transient Receptor Potential Vanilloid-5 (TRPV5) in distal renal tubules through its putative glucuronidase/sialidase activity, thereby preventing renal calcium loss. However, αKlotho also functions as the obligatory co-receptor for fibroblast growth factor-23
D Müller et al.
Genomics, 67(1), 48-53 (2000-08-17)
Functional and morphological analyses indicated that the epithelial Ca2+ channel (ECaC), which was recently cloned from rabbit kidney, exhibits the defining properties for being the gatekeeper in transcellular Ca2+ (re)absorption. Its human homologue provides, therefore, a molecular basis for achieving
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.