AV48481

Anti-OXCT1 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-3-Oxoacid CoA transferase 1, Anti-OXCT, Anti-SCOT
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 52 kDa
• Reattività contro le specie: yeast, guinea pig, rat, bovine, human, mouse, rabbit
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_000427
• N° accesso UniProt: P55809
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... OXCT1(5019)

Descrizione

Descrizione generale

3-Oxoacid CoA transferase 1 (OCT1) is a mitochondrial enzyme that catalyzes the transfer of coenzyme A from succinyl-CoA to acetoacetate during ketone body catabolism. Mutations in OXCT1 have been linked to Succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.
Rabbit Anti-OXCT1 antibody recognizes pig, bovine, chicken, human, mouse, and rat, OXCT1.

Immunogeno

Synthetic peptide directed towards the middle region of human OXCT1

Applicazioni

Rabbit Anti-OXCT1 (AB2) antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Azioni biochim/fisiol

CT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.

Sequenza

Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable