AV48240

Anti-DRG1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Developmentally regulated GTP binding protein 1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 26 kDa
• Reattività contro le specie: horse, human, rabbit, dog, guinea pig, rat, bovine, mouse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_004138
• N° accesso UniProt: Q9Y295
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... DRG1(4733)

Descrizione

Descrizione generale

Developmentally regulated GTP binding protein 1 (DRG1) is a a guanine nucleotide binding protein that functions as a potassium-dependent GTPase. It is upregulated by Lerepo4.
Rabbit Anti-DRG1 antibody recognizes human, mouse, rat, bovine, zebrafish, chicken, and rabbit DRG1.

Immunogeno

Synthetic peptide directed towards the middle region of human DRG1

Applicazioni

Rabbit Anti-DRG1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Azioni biochim/fisiol

DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.

Sequenza

Synthetic peptide located within the following region: VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable