Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV46887

Sigma-Aldrich

Anti-TSPAN12 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-NET-2, Anti-TM4SF12, Anti-Tetraspanin 12

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

35 kDa

Reattività contro le specie

mouse, dog, guinea pig, rat, bovine, horse, human, rabbit

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_036470

N° accesso UniProt

O95859

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TSPAN12(23554)

Immunogeno

Synthetic peptide directed towards the middle region of human TSPAN12

Applicazioni

Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL.

Azioni biochim/fisiol

TSPAN12 (tetraspanin 12) gene encodes a multi-pass membrane protein that belongs to tetraspanin family. TSPAN12 interacts with ADAM10 and stimulates its maturation and thereby facilitates ADAM10-dependent proteolysis of amyloid precursor protein (APP). In cancer cells, knockdown of TSPAN12 decreases membrane type-1 matrix metalloproteinase (MT1-MMP) proteolytic functions. Mutation in TSPAN12 gene results in autosomal-dominant familial exudative vitreoretinopathy.

Sequenza

Synthetic peptide located within the following region: EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

12 - Non Combustible Liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC17006

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Guohua Ji et al.
Molecules and cells, 42(7), 557-567 (2019-08-01)
TSPAN12, a member of the tetraspanin family, has been highly connected with the pathogenesis of cancer. Its biological function, however, especially in ovarian cancer (OC), has not been well elucidated. In this study, The Cancer Genome Atlas (TCGA) dataset analysis
James A Poulter et al.
American journal of human genetics, 86(2), 248-253 (2010-02-18)
Familial exudative vitreoretinopathy (FEVR) is an inherited blinding disorder of the retinal vascular system. Although mutations in three genes (LRP5, FZD4, and NDP) are known to cause FEVR, these account for only a fraction of FEVR cases. The proteins encoded
Daosong Xu et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 23(11), 3674-3681 (2009-07-10)
Using mass spectrometry, we identified ADAM10 (a membrane-associated metalloproteinase) as a partner for TSPAN12, a tetraspanin protein. TSPAN12-ADAM10 interaction was confirmed by reciprocal coimmunoprecipitation in multiple tumor cell lines. TSPAN12, to a greater extent than other tetraspanins (CD81, CD151, CD9
Marc A Lafleur et al.
Molecular biology of the cell, 20(7), 2030-2040 (2009-02-13)
Membrane type-1 matrix metalloproteinase (MT1-MMP) supports tumor cell invasion through extracellular matrix barriers containing fibrin, collagen, fibronectin, and other proteins. Here, we show that simultaneous knockdown of two or three members of the tetraspanin family (CD9, CD81, and TSPAN12) markedly

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.