Synthetic peptide directed towards the N terminal region of human SILV
Applicazioni
Anti-SILV antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.
Azioni biochim/fisiol
SILV [Silver homolog (mouse)] gene encodes a melanocyte-specific type I transmembrane glycoprotein expressed primarily in melanocytes and at low levels in normal cell lines and tissues. It facilitates in the structural organization of premelanosomes within multivesicular bodies. The encoded protein is also involved in generating internal matrix fibers that define the transition from stage I to stage II melanosomes.
Sequenza
Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Journal of investigative dermatology, 106(1), 24-27 (1996-01-01)
We have determined the DNA sequence and genomic organization of D12S53E (Pmel 17), the human homologue of the mouse silver (si) locus. D12S53E encodes a melanosomal matrix protein whose expression is closely correlated with cellular melanin content and which is
Molecular biology of the cell, 12(11), 3451-3464 (2001-11-06)
Melanosomes are tissue-specific organelles within which melanin is synthesized and stored. The melanocyte-specific glycoprotein Pmel17 is enriched in the lumen of premelanosomes, where it associates with characteristic striations of unknown composition upon which melanin is deposited. However, Pmel17 is synthesized
Questions
Reviews
★★★★★ No rating value
Active Filters
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
