Passa al contenuto
Merck
Tutte le immagini(1)

Documenti

AV46061

Sigma-Aldrich

Anti-BLK antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-B lymphoid tyrosine kinase, Anti-MGC10442

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

58 kDa

Reattività contro le specie

mouse, human, rat, pig

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_001706

N° accesso UniProt

P51451

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... BLK(640)

Immunogeno

Synthetic peptide directed towards the middle region of human BLK

Applicazioni

Anti-BLK antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Azioni biochim/fisiol

BLK, also known as B lymphoid kinase, is a 55kDa tyrosine kinase with SH3, SH2 and catalytic domains that contain consensus sequences of the Src protein tyrosine kinase family. BLK is expressed specifically in the B cell lineage and plays a role in signal transduction pathway that is restricted to B lymphoid cells. Stimulation of resting B-lymphocytes with antibodies to surface immunoglobulin (sIgD or sIgM) induces activation of BLK.

Sequenza

Synthetic peptide located within the following region: AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

A L Burkhardt et al.
Proceedings of the National Academy of Sciences of the United States of America, 88(16), 7410-7414 (1991-08-15)
Stimulation of resting B lymphocytes with antibodies to surface immunoglobulin (sIgD or sIgM) induces protein tyrosine phosphorylation, implicating one or more B-cell protein-tyrosine kinases (PTKs) in sIg signal transduction. We have evaluated whether members of the src family of PTKs
S M Dymecki et al.
Science (New York, N.Y.), 247(4940), 332-336 (1990-01-19)
Several pathways of transmembrane signaling in lymphocytes involve protein-tyrosine phosphorylation. With the exception of p56lck, a tyrosine kinase specific to T lymphoid cells that associates with the T cell transmembrane proteins CD4 and CD8, the kinases that function in these

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.