Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV46038

Sigma-Aldrich

Anti-MTHFD2 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, Anti-NMDMC

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 417.00

CHF 417.00


Spedizione prevista il28 maggio 2025



Scegli un formato

Cambia visualizzazione
100 μL
CHF 417.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 417.00


Spedizione prevista il28 maggio 2025


Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

35 kDa

Reattività contro le specie

human, rabbit, dog, bovine, mouse, rat, horse, guinea pig

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... MTHFD2(10797)

Immunogeno

Synthetic peptide directed towards the N terminal region of human MTHFD2

Applicazioni

Anti-MTHFD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Azioni biochim/fisiol

MTHFD2 encodes a mitochondrial bifunctional enzyme methylenetetrahydrofolate dehydrogenase/cyclohydrolase with NAD-dependent methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase domain. Decrease in MTHFD2 expression leads to impairment of cell migration and invasion into extracellular matrix and reduces the cell fraction with a high CD44 expression. It facilitates the regulation of breast cancer cell migration and invasion.

Sequenza

Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Laura Lehtinen et al.
Oncotarget, 4(1), 48-63 (2013-01-09)
Vimentin is an intermediate filament protein, with a key role in the epithelial to mesenchymal transition as well as cell invasion, and it is often upregulated during cancer progression. However, relatively little is known about its regulation in cancer cells.

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.