AV45646

Anti-NR4A3 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-CHN, Anti-CSMF, Anti-MINOR, Anti-NOR1, Anti-Nuclear receptor subfamily 4, group A, member 3, Anti-TEC
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 4

Proprietà

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 68 kDa
• species reactivity: mouse, rat, rabbit, pig, human, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_008912
• UniProt accession no.: Q92570
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NR4A3(8013)

Descrizione

Immunogen

Synthetic peptide directed towards the middle region of human NR4A3

Application

Anti-NR4A3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Biochem/physiol Actions

Nuclear receptor subfamily 4, group A, member 3 (NR4A3; NOR1) is an orphan receptor belonging to the steroid-thyroid hormone-retinoid receptor superfamily. It binds the NGFI-B Response Element (NBRE) and acts as transcriptional activator. NR4A3 is a regulator of mast cell function, inflammation and insulin gene expression.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Classe di stoccaggio: 10 - Combustible liquids
• Che succede?: WGK 3
• Punto di infiammabilità (°F): Not applicable
• Punto di infiammabilità (°C): Not applicable