Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV44247

Sigma-Aldrich

Anti-MICA antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-DAQB-48K1.7, Anti-MGC111087, Anti-MHC class I polypeptide-related sequence A, Anti-PERB11.1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

42 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... MICA(4276)

Immunogeno

Synthetic peptide directed towards the middle region of human MICA

Applicazioni

Anti-MICA antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Azioni biochim/fisiol

MHC Class I polypeptide-related sequences A and B (MICA and MICB) are surface glycoproteins expressed constitutively on the enterocytes. They act as ligands for the natural killer group 2, member D (NKG2D) immunoreceptor activation. MICA binds NKG2D receptor and activates the CD8+T cells. Tissue damage or increased expression of MICA results in auto-antibodies detected in early-onset systemic lupus erythematosus and celiac disease.

Sequenza

Synthetic peptide located within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Antonio López-Vázquez et al.
BMC medicine, 12, 34-34 (2014-02-26)
Overexpression of autologous proteins can lead to the formation of autoantibodies and autoimmune diseases. MHC class I polypeptide-related sequence A (MICA) is highly expressed in the enterocytes of patients with celiac disease, which arises in response to gluten. The aim
Zhenpeng Dai et al.
The Journal of experimental medicine, 206(4), 793-805 (2009-03-18)
The NKG2D receptor stimulates natural killer cell and T cell responses upon engagement of ligands associated with malignancies and certain autoimmune diseases. However, conditions of persistent NKG2D ligand expression can lead to immunosuppression. In cancer patients, tumor expression and shedding
S Bahram et al.
Proceedings of the National Academy of Sciences of the United States of America, 91(14), 6259-6263 (1994-07-05)
Major histocompatibility complex (MHC) class I genes typically encode polymorphic peptide-binding chains which are ubiquitously expressed and mediate the recognition of intracellular antigens by cytotoxic T cells. They constitute diverse gene families in different species and include the numerous so-called
Natasja Nielsen et al.
Immunology, 142(4), 581-593 (2014-03-29)
Rheumatoid arthritis (RA) is an autoimmune disease characterized by chronic inflammation and synovial hyperplasia leading to progressive joint destruction. Fibroblast-like synoviocytes (FLS) are central components of the aggressive, tumour-like synovial structure termed pannus, which invades the joint space and cartilage.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.