AV44167
Anti-SLC19A1 antibody produced in rabbit
IgG fraction of antiserum
Sinonimo/i:
Anti-CHMD, Anti-FOLT, Anti-IFC1, Anti-REFC, Anti-RFC1, Anti-Solute carrier family 19 (folate transporter), member 1
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Scegli un formato
100 μL
CHF 417.00
CHF 417.00
Check Cart for Availability
Per il tuo target è disponibile un anticorpo ricombinante privo di conservanti. Prova ZRB1461
Scegli un formato
Cambia visualizzazione
100 μL
CHF 417.00
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
CHF 417.00
Check Cart for Availability
Per il tuo target è disponibile un anticorpo ricombinante privo di conservanti. Prova ZRB1461
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
PM
65 kDa
Reattività contro le specie
human
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... SLC19A1(6573)
Descrizione generale
Solute carrier family 19 (folate transporter), member 1 (SLC19A1, CHMD, FOLT, RFC1, IFC1) is a major carrier-mediated transporter in mammalian cells for the uptake of reduced folates and antifolate-based anticancer drugs such as methotrexate. RFC activity can be considered as a potential marker for predicting response to antifolate chemotherapy.
Specificità
Anti-SLC19A1 polyclonal antibody reacts with human solute carrier family 19 (folate transporter), member 1.
Immunogeno
Synthetic peptide directed towards the N terminal region of human SLC19A1
Applicazioni
Anti-SLC19A1 polyclonal antibody is used to tag solute carrier family 19 (folate transporter), member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 19 (folate transporter), member 19 in carrier-mediated reduced folate uptake.
Azioni biochim/fisiol
Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].
Sequenza
Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Raccomandato
N° Catalogo
Descrizione
Determinazione del prezzo
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Letter to the editor.
Gokce Gurler et al.
Neuropathology and applied neurobiology, 50(2), e12969-e12969 (2024-03-18)
Gokce Gurler et al.
Fluids and barriers of the CNS, 20(1), 47-47 (2023-06-17)
Reduced folate carrier 1 (RFC1; SLC19a1) is the main responsible transporter for the B9 family of vitamins named folates, which are essential for normal tissue growth and development. While folate deficiency resulted in retinal vasculopathy, the expression and the role of RFC1 in
Vishal Sangha et al.
Fluids and barriers of the CNS, 21(1), 67-67 (2024-08-28)
Folates are a family of B9 vitamins essential for normal growth and development in the central nervous system (CNS). Transport of folates is mediated by three major transport proteins: folate receptor alpha (FRα), proton-coupled folate transporter (PCFT), and reduced folate
Camille Alam et al.
Molecular pharmaceutics, 14(11), 3848-3858 (2017-09-09)
Folates are essential for brain development and function. Folate transport in mammalian tissues is mediated by three major folate transport systems, i.e., reduced folate carrier (RFC), proton-coupled folate transporter (PCFT), and folate receptor alpha (FRα), known to be regulated by
Julian C Gilmore et al.
EBioMedicine, 75, 103771-103771 (2021-12-27)
Due to the critical role of folates in neurodevelopment, it is important to understand potential interactions between anti-HIV drugs used during pregnancy, and folate delivery pathways in the placenta. This study investigates the effect of dolutegravir (DTG) exposure on the
Active Filters
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.
