AV43761

Anti-SLC25A25 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-KIAA1896, Anti-MCSC, Anti-MGC105138, Anti-PCSCL, Anti-SCAMC-2, Anti-Solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Coniugato: unconjugated
• application: WB
• Clone: polyclonal
• Reattività contro le specie: horse, human, bovine, dog, rabbit, guinea pig, rat, mouse
• citations: 2
• tecniche: western blot: suitable

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 55 kDa
• Reattività contro le specie: horse, human, bovine, dog, rabbit, guinea pig, rat, mouse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_001006642
• N° accesso UniProt: Q6KCM6
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SLC25A25(114789)

Descrizione

Immunogeno

Synthetic peptide directed towards the N terminal region of human SLC25A25

Azioni biochim/fisiol

SLC25A25 is a member of family of calcium-binding mitochondrial carriers located in the inner membranes of mitochondria. It is ATP-Mg/Pi carrier and regulates the movement of adenine nucleotides in mitochondria. SLC25A25 maintains the homeostasis of ATP and Ca⁺² cycling in the skeletal muscle.

Sequenza

Synthetic peptide located within the following region: AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable