AV41591

Anti-VSIG4 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-V-set and immunoglobulin domain containing 4, Anti-Z39IG
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 44 kDa
• Reattività contro le specie: pig, human, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_009199
• N° accesso UniProt: Q9Y279
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... VSIG4(11326)

Descrizione

Descrizione generale

Adaptive immune response involving activated lymphocytes requires the engagement of T-cell receptors by antigenic peptide-MHC complexes (APC). B7 family members are involved in the regulation of T-cell activation by APCs. V-set and immunoglobulin domain containing 4 (VSIG4, Z39IG), a B7 family-related protein, has been identified as a negative regulator of T-cell activation. VSIG4 may play a role in inhibiting processes such as interstitial fibrosis.

Specificità

Anti-VSIG4 polyclonal antibody reacts with bovine, human, mouse, and rat V-set and immunoglobulin domain containing 4 proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human VSIG4

Applicazioni

Anti-VSIG4 polyclonal antibody is used to tag V-set and immunoglobulin domain containing 4 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of V-set and immunoglobulin domain containing 4 as a negative regulator of T-cell activation during adaptive immune response.

Azioni biochim/fisiol

T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

Sequenza

Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable