Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV41187

Sigma-Aldrich

Anti-CPEB2 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Cytoplasmic polyadenylation element binding protein 2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

37 kDa

Reattività contro le specie

dog, guinea pig, rat, rabbit, bovine, mouse, human, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CPEB2(132864)

Descrizione generale

Cytoplasmic polyadenylation element binding protein 2 (CPEB2) is an RNA binding protein that regulates cytoplasmic polyadenylation and translation of mRNAs in germ cells and neural cells. CPEB2 is involved in the regulation of the oxygen homoeostasis transcriptional master regulator gene hypoxia-inducible factor-1 (HIF-1).

Specificità

Anti-CPEB2 polyclonal antibody reacts with bovine, chicken, canine, pig, human, mouse, rat, and zebrafish cytoplasmic polyadenylation element binding protein 2 proteins.

Immunogeno

Synthetic peptide directed towards the middle region of human CPEB2

Applicazioni

Anti-CPEB2 polyclonal antibody is used to tag cytoplasmic polyadenylation element binding protein 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CPEB2 in the regulation of mRNA transcription in germ cells and neural cells.

Azioni biochim/fisiol

CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Sequenza

Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

12 - Non Combustible Liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.