AV41187

Anti-CPEB2 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Cytoplasmic polyadenylation element binding protein 2
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Coniugato: unconjugated
• application: WB
• Clone: polyclonal
• Reattività contro le specie: dog, guinea pig, rat, rabbit, bovine, mouse, human, horse
• tecniche: western blot: suitable

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 37 kDa
• Reattività contro le specie: dog, guinea pig, rat, rabbit, bovine, mouse, human, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_872291
• N° accesso UniProt: Q7Z5Q1
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CPEB2(132864)

Descrizione

Descrizione generale

Cytoplasmic polyadenylation element binding protein 2 (CPEB2) is an RNA binding protein that regulates cytoplasmic polyadenylation and translation of mRNAs in germ cells and neural cells. CPEB2 is involved in the regulation of the oxygen homoeostasis transcriptional master regulator gene hypoxia-inducible factor-1 (HIF-1).

Specificità

Anti-CPEB2 polyclonal antibody reacts with bovine, chicken, canine, pig, human, mouse, rat, and zebrafish cytoplasmic polyadenylation element binding protein 2 proteins.

Immunogeno

Synthetic peptide directed towards the middle region of human CPEB2

Applicazioni

Anti-CPEB2 polyclonal antibody is used to tag cytoplasmic polyadenylation element binding protein 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CPEB2 in the regulation of mRNA transcription in germ cells and neural cells.

Azioni biochim/fisiol

CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Sequenza

Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable