AV38090

Anti-EGR4 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Early growth response 4
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 51 kDa
• Reattività contro le specie: rat, horse, mouse, dog, rabbit, bovine, human, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_001956
• N° accesso UniProt: Q05215
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... EGR4(1961)

Descrizione

Descrizione generale

Early growth response (Egr) proteins are transcriptional regulators (Egr1-4) of gene expression involved in the growth and differentiation of many cells. Early growth response 4 (EGR4, NGFI-C, pAT133), a member of the Egr family of zinc-finger transcription factors, regulates early stage meiosis and functions as a master gene transcription regulator of processes such as spermatogenesis and male fertility. Egr4 is an important component in the mechanism for trophic factor-mediated upregulation of K-Cl cotransporter (KCC2) in immature neurons.

Specificità

Anti-EGR4 polyclonal antibody reacts with human, mouse, rat, canine, zebrafish, bovine, and chicken early growth response 4 proteins.

Immunogeno

Synthetic peptide directed towards the C terminal region of human EGR4

Applicazioni

Anti-EGR4 polyclonal antibody is used to tag early growth response 4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of early growth response 4 protein in spermatogenesis and male fertility.

Azioni biochim/fisiol

The nerve growth factor-induced clone C (NGFI-C/EGR4) gene is a zinc-finger transcription factor that is rapidly induced by nerve growth factor in rat pheochromocytoma PC12 cells and by seizure in brain. NGFI-C/EGR4 is closely related to the previously described early response genes, nerve growth factor-induced clone A (NGFI-A or EGR1), EGR2, and EGR3. These four early response (immediate early) proteins all contain very similar zinc-finger DNA binding domains and five highly homologous subdomains. EGR-4 functionally cooperate with NFAT proteins and induce expression of IL-2 and TNFalpha. Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.

Sequenza

Synthetic peptide located within the following region: RSDHLTSHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEER

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable