AV37106

Anti-NFATC2 antibody produced in rabbit

IgG fraction of antiserum

• Numero MDL: MFCD02263821
• Codice UNSPSC: 12352203
• NACRES: NA.43

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 100 kDa
• Reattività contro le specie: mouse, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_001032254
• N° accesso UniProt: Q60591-3
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: mouse ... NFATC2(18019)

Descrizione

Descrizione generale

Nuclear factor of activated T-cells, cytoplasmic 2(NFATC2) is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). Upon T cell receptor (TCR) stimulation, NFATC2 gets translocated from the cytoskeleton to the nucleus where it becomes a component of the the nuclear factors of activated T cells transcription complex. It plays a role in regulating expression of genes critical for cell cycle progression during lymphocyte activation.

Immunogeno

Synthetic peptide directed towards the N terminal region of mouse NFATC2

Azioni biochim/fisiol

NFATC2 is a member of The NF-AT family of potent transcription factors that are essential for T cell activation

Sequenza

Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable