Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV35579

Sigma-Aldrich

Anti-CACNB1 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-CAB1, Anti-CACNLB1, Anti-CCHLB1, Anti-Calcium channel, voltage-dependent, β 1 subunit, Anti-MGC41896

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 356.00

CHF 356.00


Spedizione prevista il02 giugno 2025



Scegli un formato

Cambia visualizzazione
100 μL
CHF 356.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 356.00


Spedizione prevista il02 giugno 2025


Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

58 kDa

Reattività contro le specie

guinea pig, rabbit, bovine, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CACNB1(782)

Immunogeno

Synthetic peptide directed towards the middle region of human CACNB1

Azioni biochim/fisiol

CACNB1 belongs to the calcium channel b subunit family. It has important roles in the modulation of calcium channels and calcium current, as well as in voltage-dependent activation and inactivation of calcium channels.

Sequenza

Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 2

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

K Hogan et al.
Neuroscience letters, 277(2), 111-114 (2000-01-07)
The structure of the gene encoding the human brain beta1 subunit of voltage dependent calcium channels (CACNB1) was determined by comparison of its genomic sequence with beta1 cDNA sequence. CACNB1 is distributed over 25 kb and contains 13 exons. Alternative
Wanchana Jangsangthong et al.
Pflugers Archiv : European journal of physiology, 459(3), 399-411 (2009-10-13)
Voltage-dependent calcium channel (Ca(v)) pores are modulated by cytosolic beta subunits. Four beta-subunit genes and their splice variants offer a wide structural array for tissue- or disease-specific biophysical gating phenotypes. For instance, the length of the N terminus of beta(2)

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.