AV33888

Anti-KLK6 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Bssp, Anti-Kallikrein-related peptidase 6, Anti-Klk7, Anti-MGC9355, Anti-NEUROSIN, Anti-PRSS18, Anti-PRSS9, Anti-SP59
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 25 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_001012982
• N° accesso UniProt: Q92876
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... KLK6(5653)

Descrizione

Descrizione generale

Kallikrein-6 (KLK6) also known as zyme is part of a family of serine proteases that targets xtracellular proteins including fibronectin, vitronectin and laminin. It is found highly expressed in the brain where it has been shown to be involved in degradation of amyloid plaque protein. Additionally, it has been implicated in carcinogensis and is being investigated for its potential as a target for cancer therapy.

Immunogeno

Synthetic peptide directed towards the N terminal region of human KLK6

Azioni biochim/fisiol

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene that encodes KLK6 protein is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. KLK6 is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer′s disease.Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. The encoded enzyme is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer′s disease. Multiple alternatively spliced transcript variants that encode different isoforms have been identified for this gene.

Sequenza

Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable