AV32790

Anti-ACAT2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Acetyl-coenzyme A acetyltransferase 2 (acetoacetyl coenzyme A thiolase)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 41 kDa
• Reattività contro le specie: human, bovine, guinea pig, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_005882
• N° accesso UniProt: Q9BWD1
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ACAT2(39)

Descrizione

Descrizione generale

ACAT2 is an acyl-coenzyme A cholesterol acyltransferase that regulates the esterification of cholesterol in cells. ACAT2 has been recommended as a treatment target for hypercholesterolemia and atherosclerosis. It has also been implicated in the inhibition of apoB secretion in liver cells.
Rabbit Anti-ACAT2 (AB1) antibody recognizes bovine, human, mouse, and rat ACAT2.

Immunogeno

Synthetic peptide directed towards the middle region of human ACAT2

Applicazioni

Rabbit Anti-ACAT2 (AB1) antibody can be used for western blot applications at a concentration of 1 μg/ml. It can also be used for IHC applications at 4-8 μg/ml.

Azioni biochim/fisiol

Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Sequenza

Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable