Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV31085

Sigma-Aldrich

Anti-ELF1 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-E74-like factor 1 (ets domain transcription factor)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 474.00

CHF 474.00


Spedizione prevista il11 maggio 2025



Scegli un formato

Cambia visualizzazione
100 μL
CHF 474.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 474.00


Spedizione prevista il11 maggio 2025


Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

67 kDa

Reattività contro le specie

rat, bovine, dog, human, guinea pig, rabbit, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ELF1(1997)

Descrizione generale

ELF1 is known to function as a transcription factor that regulates the Tie2 gene during blood vessel development. Elf1 has also been implicated in the regulation of terminal transferase gene.
Rabbit Anti-ELF1 (AB2) antibody recognizes rat, human, bovine, canine, and mouse ELF1.

Immunogeno

Synthetic peptide directed towards the N terminal region of human ELF1

Applicazioni

Rabbit Anti-ELF1 (AB2) antibody is suitable for use in western blot (1μg/ml) applications.

Azioni biochim/fisiol

ELF1 belongs to the ETS family. It contains 1 ETS DNA-binding domain. ELF1 is a transcription factor that activates the LYN and BLK promoters. It appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. ELF1 binds specifically to two purine-rich motifs in the HIV-2 enhancer.

Sequenza

Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

A Dube et al.
Circulation research, 88(2), 237-244 (2001-02-07)
Vascular development requires the tightly coordinated expression of several growth factors and their receptors. Among these are the Tie1 and Tie2 receptors, which are almost exclusively endothelial cell-specific. The critical transcriptional regulators of vascular-specific gene expression remain largely unknown. The
P Ernst et al.
Molecular and cellular biology, 16(11), 6121-6131 (1996-11-01)
The terminal deoxynucleotidyltransferase (TdT) gene represents an attractive model for the analysis of gene regulation during an early phase of lymphocyte development. In previous studies, we identified a DNA element, termed D', which is essential for TdT promoter activity in

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.