Passa al contenuto
Merck
Tutte le immagini(1)

Documenti

AV30042

Sigma-Aldrich

Anti-KLF11 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Kruppel-like factor 11

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

55 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KLF11(8462)

Immunogeno

Synthetic peptide directed towards the N terminal region of human KLF11

Applicazioni

Anti-KLF11 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.

Azioni biochim/fisiol

KLF11 belongs to KLF family of transcription factors that regulate GC promoters and important metabolic processes in diverse organisms. The histone acetyltransferase pathways mediated by KLF11 affect the regulation of insulin in neonatal diabetes. KLF11 mediates increase in basal insulin levels and glucose-stimulated insulin secretion. It suppresses inflammatory activation of endothelial cells by inhibition of NF-κB pathway that results in downregulation of VCAM-1 and E-selectin promoters.

Sequenza

Synthetic peptide located within the following region: SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQ

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Gwen Lomberk et al.
The Journal of biological chemistry, 288(24), 17745-17758 (2013-04-17)
The function of Krüppel-like factor 11 (KLF11) in the regulation of metabolic pathways is conserved from flies to human. Alterations in KLF11 function result in maturity onset diabetes of the young 7 (MODY7) and neonatal diabetes; however, the mechanisms underlying
Yanbo Fan et al.
Arteriosclerosis, thrombosis, and vascular biology, 32(12), 2981-2988 (2012-10-09)
Endothelial cell (EC) inflammatory status is critical to many vascular diseases. Emerging data demonstrate that mutations of Krüppel-like factor-11 (KLF11), a gene coding maturity-onset diabetes mellitus of the young type 7 (MODY7), contribute to the development of neonatal diabetes mellitus.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.