AV30037

Anti-GLIS2 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-GLIS family zinc finger 2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 56 kDa
• Reattività contro le specie: dog, human, horse, bovine, rat, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_115964
• N° accesso UniProt: Q9BZE0
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... GLIS2(84662)

Descrizione

Descrizione generale

GLIS family zinc finger 2 (GLIS2), a Krüppel-like zinc finger protein family member with transactivation and repressor functions, is involved in kidney development, the maintenance of normal renal function and neurogenesis. Glis2 interacts with β-catenin and may function as a negative modulator of β-catenin/TCF-mediated transcription. Defective GLIS2 has been linked to the development of nephronophthisis.

Rabbit polyclonal anti-GLIS2 antibody reacts with canine, human, chicken, rat, bovine, and mouse GLIS family zinc finger 2 transcription factors.

Immunogeno

Synthetic peptide directed towards the N terminal region of human GLIS2

Applicazioni

Rabbit polyclonal anti-GLIS2 antibody is used to tag GLIS family zinc finger 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of GLIS family zinc finger 2 in kidney development and maintenance. Anti-GLIS2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Azioni biochim/fisiol

Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.

Sequenza

Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable