APREST81566

PrEST Antigen KIF7

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Sinonimo/i: JBTS12
• Codice UNSPSC: 12352202

Proprietà

• Ricombinante: expressed in E. coli
• Saggio: >80% (SDS-PAGE)
• Forma fisica: buffered aqueous solution
• PM: predicted mol wt 30 kDa
• Purificato mediante: immobilized metal affinity chromatography (IMAC)
• Concentrazione: ≥0.5 mg/mL
• Sequenza immunogenica: MWINQELKQKLGGVNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGE
• N° accesso Ensembl | uomo: ENSG00000166813
• N° accesso UniProt: Q2M1P5
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... KIF7(374654)

Descrizione

Descrizione generale

Recombinant protein fragment of Human KIF7 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Applicazioni

Suitable as a blocking agent using corresponding antibodies.

Linkage

Corresponding Antibody HPA043145.

Stato fisico

Solution in 1 M urea-PBS, pH 7.4

Nota sulla preparazione

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Note legali

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable