Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

MAB2290

Sigma-Aldrich

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

clone 29A3, Chemicon®, from mouse

Sinonimo/i:

CD49c

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μG
CHF 484.00

CHF 484.00


Spedizione prevista il16 maggio 2025

Per il tuo target è disponibile un anticorpo ricombinante privo di conservanti. Prova ZRB1389

Richiedi un ordine bulk

Scegli un formato

Cambia visualizzazione
100 μG
CHF 484.00

About This Item

Codice UNSPSC:
12352203
eCl@ss:
32160702
NACRES:
NA.41

CHF 484.00


Spedizione prevista il16 maggio 2025

Per il tuo target è disponibile un anticorpo ricombinante privo di conservanti. Prova ZRB1389

Richiedi un ordine bulk

Origine biologica

mouse

Livello qualitativo

Forma dell’anticorpo

purified antibody

Tipo di anticorpo

primary antibodies

Clone

29A3, monoclonal

Reattività contro le specie

human

Produttore/marchio commerciale

Chemicon®

tecniche

immunocytochemistry: suitable
immunohistochemistry: suitable
western blot: suitable

Isotipo

IgG1

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ITGA3(3675)

Descrizione generale

MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.

Specificità

Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.

SPECIES REACTIVITIES:

Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.

Immunogeno

Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY

Applicazioni

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Western Blot

Immunocytochemistry

Immunohistochemistry (Frozen Sections)

Optimal working dilutions must be determined by the end user.

Stato fisico

Format: Purified
Purified. Liquid in PBS containing 0.01% sodium azide.

Altre note

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Note legali

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

12 - Non Combustible Liquids

Classe di pericolosità dell'acqua (WGK)

WGK 2

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Frédéric Dallaire et al.
Journal of virology, 83(11), 5329-5338 (2009-03-20)
The human adenovirus E4orf6 and E1B55K proteins promote viral replication by targeting several cellular proteins for degradation. The E4orf6 product has been shown by our group and others to form an E3 ubiquitin ligase complex that contains elongins B and
Jake D Howden et al.
BMC biology, 19(1), 130-130 (2021-06-24)
Keratinocytes form the main protective barrier in the skin to separate the underlying tissue from the external environment. In order to maintain this barrier, keratinocytes form robust junctions between neighbouring cells as well as with the underlying extracellular matrix. Cell-cell
Chi Ying Cheng et al.
Journal of virology, 85(2), 765-775 (2010-11-12)
Although human adenovirus type 5 (Ad5) has been widely studied, relatively little work has been done with other human adenovirus serotypes. The Ad5 E4orf6 and E1B55K proteins form Cul5-based E3 ubiquitin ligase complexes to degrade p53, Mre11, DNA ligase IV
Role of integrins in the assembly and function of hensin in intercalated cells.
Vijayakumar, S; Erdjument-Bromage, H; Tempst, P; Al-Awqati, Q
Journal of the American Society of Nephrology null

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.