Accéder au contenu
Merck
Toutes les photos(6)

Principaux documents

WH0002119M2

Sigma-Aldrich

Monoclonal Anti-ETV5 antibody produced in mouse

clone 7C10, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-ERM, Anti-ets variant gene 5 (ets-related molecule)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
427.00 CHF

427.00 CHF

Date d'expédition estimée le16 avril 2025

Toutes les photos(6)

Sélectionner une taille de conditionnement

Changer de vue
100 μG
427.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

427.00 CHF

Date d'expédition estimée le16 avril 2025

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

7C10, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human, mouse, rat

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

NM_004454

Numéro d'accès UniProt

P41161

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ETV5(2119)

Catégories apparentées

Description générale

E-twenty-six (Ets) variant gene 5 (ETV5) protein belongs to the polyoma enhancer activator 3 (PEA3) subfamily of ETS transcription factors. The ETV5 gene is located on the human chromosome at 3q27.2.

Immunogène

ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM

Application

Monoclonal Anti-ETV5 antibody produced in mouse has been used in western blotting[1] (1:1000)[2][3].

Actions biochimiques/physiologiques

E-twenty-six (Ets) variant gene 5 (ETV5) gene is responsible for the survival, proliferation, and self-renewal of spermatogonial stem cells (SSCs). ETV5 protein plays a role in mediating glial cell line-derived neurotrophic factor (GDNF) signaling and induces several genes required for regulating SSC fate. It is involved in limb development and regulates epithelial-mesenchymal transition in several cancer cells. ETV5 protein binds to the conserved GGAA/T motif and regulates gene expression.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
08182-7C10
06286-7C10

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Erik Melén et al.
The Journal of allergy and clinical immunology, 126(3), 631-637 (2010-09-08)
Epidemiologic studies consistently show associations between asthma and obesity. Shared genetics might account for this association. We sought to identify genetic variants associated with both asthma and obesity. On the basis of a literature search, we identified genes from (1)
Lee Huang et al.
Cancer research, 81(8), 2071-2085 (2021-02-03)
The failure of once promising target-specific therapeutic strategies often arises from redundancies in gene expression pathways. Even with new melanoma treatments, many patients are not responsive or develop resistance, leading to disease progression in terms of growth and metastasis. We
Xin Wu et al.
Biology of reproduction, 85(6), 1114-1123 (2011-08-06)
Insight regarding mechanisms controlling gene expression in the spermatogonial stem cell (SSC) will improve our understanding of the processes regulating spermatogenesis and aid in treating problems associated with male infertility. In the present study, we explored the global gene expression
Duy Pham et al.
The Journal of allergy and clinical immunology, 134(1), 204-214 (2014-02-04)
The differentiation of TH17 cells, which promote pulmonary inflammation, requires the cooperation of a network of transcription factors. We sought to define the role of Etv5, an Ets-family transcription factor, in TH17 cell development and function. TH17 development was examined
Severa Bunda et al.
Nature communications, 10(1), 661-661 (2019-02-10)
Capicua (CIC) is a transcriptional repressor that counteracts activation of genes downstream of receptor tyrosine kinase (RTK)/Ras/ERK signaling. It is well-established that tumorigenesis, especially in glioblastoma (GBM), is attributed to hyperactive RTK/Ras/ERK signaling. While CIC is mutated in other tumors
Afficher tous les articles scientifiques apparentés

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique