SAB5702529

Anti-Caveolin-3 Antibody, clone 4G5W2, Rabbit Monoclonal

• Synonyme(s) : LGMD1C, LQT9, VIP-21, VIP21
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 4G5W2, monoclonal
• Forme: liquid
• Poids mol.: 19 kDa
• Espèces réactives: human, rat, rat
• Concentration: 0.5 mg/mL
• Technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
• Numéro d'accès UniProt: P56539
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CAV3(859)

Description

Description générale

This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq, Jul 2008]

Immunogène

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human Caveolin-3 (P56539).

Application

WB, IHC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1