SAB5702182

Anti-PLA2G2A Antibody, clone 3X9F5, Rabbit Monoclonal

• Synonyme(s) : PLA2G2A, MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2, phospholipase A2 group IIA
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 3X9F5, monoclonal
• Forme: liquid
• Poids mol.: 15 kDa
• Espèces réactives: rat, human, rat
• Concentration: 1.00 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: VTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC
• Numéro d'accès UniProt: P14555
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PLA2G2A(5320)

Description

Description générale

The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5′ UTRs have been found for this gene.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 65-144 of human PLA2G2A (P14555).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1