SAB5702104

Anti-DCTN5 Antibody, clone 9W2S4, Rabbit Monoclonal

• Synonyme(s) : DCTN5, dynactin subunit 5
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 9W2S4, monoclonal
• Forme: liquid
• Poids mol.: 20 kDa
• Espèces réactives: rat, human, rat
• Concentration: 1.50 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
• Numéro d'accès UniProt: Q9BTE1
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... DCTN5(84516)

Description

Description générale

This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene of this gene is located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogène

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human DCTN5 (Q9BTE1).

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1