SAB2103568

Anti-LCN1 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

• Synonyme(s) : Anti-MGC71975, Anti-PMFA, Anti-TP, Anti-VEGP
• Numéro MDL: MFCD01864741
• Code UNSPSC : 12352203

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: lyophilized powder
• Poids mol.: 17 kDa
• Espèces réactives: mouse, human, rat, pig
• Technique(s): western blot: suitable
• Séquence immunogène: IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG
• Numéro d'accès NCBI: NM_002297
• Numéro d'accès UniProt: P31025
• Température de stockage: −20°C
• Informations sur le gène: human ... LCN1(3933)

Description

Immunogène

Peptide region of the protein sequence according to NP_002288.

Forme physique

Antibody is lyophilized from PBS buffer with 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable