SAB2102232

Anti-SMAD4 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-DPC4, Anti-JIP, Anti-MADH4, Anti-SMAD family member 4
• Numéro MDL: MFCD01634190
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Forme d'anticorps: affinity isolated antibody
• Niveau de qualité: 100
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 60 kDa
• Espèces réactives: horse, bovine, sheep, guinea pig, dog, mouse, human, rat, rabbit, goat
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès UniProt: Q13485
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SMAD4(4089)

Description

Immunogène

Synthetic peptide directed towards the N terminal region of human SMAD4

Actions biochimiques/physiologiques

SMAD4 is one of the Smad family members, which are essential intracellular signalling components of the transforming growth factor-beta (TGF-beta) superfamily. Smad2 and Smad3 are structurally highly similar and mediate TGF-beta signals. Smad4 is distantl

Séquence

Synthetic peptide located within the following region: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable