Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB2100330

Sigma-Aldrich

Anti-CACNB2 (ab1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Calcium channel, voltage-dependent, β 2 subunit, Anti-FLJ23743, Anti-MYSB

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

68 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès UniProt

Q08289

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CACNB2(783)

Description générale

Calcium voltage-gated channel auxiliary subunit beta 2 (CACNB2) is a part of voltage-gated calcium channel gene superfamily and encodes Cavβ2 subunit. In human chromosome, the gene CACNB2 is localized on 10p12.33-p12.31.

Immunogène

Synthetic peptide directed towards the middle region of human CACNB2

Actions biochimiques/physiologiques

CACNB2 contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRS4). CACNB2 is associated with systolic blood pressure and hypertension. Downregulation of CACNB2 expression leads to atrial fibrillation. Mutations in CACNB2 causes dysregulation of calcium levels in cells leading to autism spectrum disorder. Single nucleotide polymorphism in CACNB2 gene is associated with bipolar disorder and schizophrenia.

Séquence

Synthetic peptide located within the following region: HLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis
Smoller JW
Lancet, 381(9875), 1371-1379 (2013)
The dark side of the QT interval. The Short QT Syndrome: pathophysiology, clinical presentation and management
Comelli I, et al.
Emergency Care Journal, 8(3), 41-47 (2012)
Regulation of cardiac CACNB2 by microRNA-499: Potential role in atrial fibrillation
Ling TY, et al.
BBA Clinical, 7(9875), 78-84 (2017)
Alexandra F S Breitenkamp et al.
PloS one, 9(4), e95579-e95579 (2014-04-23)
Autism Spectrum Disorders (ASD) are complex neurodevelopmental diseases clinically defined by dysfunction of social interaction. Dysregulation of cellular calcium homeostasis might be involved in ASD pathogenesis, and genes coding for the L-type calcium channel subunits CaV1.2 (CACNA1C) and CaVβ2 (CACNB2)
Yinghua Lin et al.
Atherosclerosis, 219(2), 709-714 (2011-10-04)
Two large-scale genome-wide association studies (GWAs) have identified multiple variants associated with blood pressure (BP) or hypertension. The present study was to investigate whether some variations were associated with BP traits and hypertension or even prehypertension in adult She ethnic

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique