SAB1411193

Anti-RGS3 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, RGP3
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen 19.5 kDa
• Espèces réactives: human
• Technique(s): western blot: 1 μg/mL
• Numéro d'accès NCBI: NM_134427
• Numéro d'accès UniProt: P49796
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... RGS3(5998)

Description

Description générale

This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known. (provided by RefSeq)

Immunogène

RGS3 (NP_602299.1, 1 a.a. ~ 168 a.a) full-length human protein.

Sequence
MKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable