Accéder au contenu
Merck
Toutes les photos(1)

Documents

QPREST27836

Sigma-Aldrich

SILu™PrEST ZCPW2

SILuPrESTs Powered by Atlas Antibodies, buffered aqueous solution

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352200

Produit recombinant

expressed in E. coli LysA ArgA BL21(DE3)

Pureté

>80% (SDS-PAGE)

Forme

buffered aqueous solution

Poids mol.

predicted mol wt 26kDa including tags

Produit purifié par

immobilized metal affinity chromatography (IMAC)

Conditionnement

pkg of 1nmol × 5 vials

Conditions de stockage

avoid repeated freeze/thaw cycles

Séquence immunogène

TATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF

Numéro d'accès UniProt

Q504Y3

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... ZCPW2(152098)

Description générale

Lys, Arg 13C and 15N metabolically labeled recombinant human protein fragment

Application

Internal standard in MS-based quantitative proteomics

Forme physique

Heavy proteins are provided in solution of 1M Urea PBS, pH 7.4

Notes préparatoires

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Remarque sur l'analyse

Isotopic Label Incorporation

The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.
A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G.
All SILuPrESTs contain an N-terminal His6ABP fusion tag, used for accurate determination of concentration. The fusion tag sequence is:

GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.

The specific human protein sequence begins directly after ′VDKLAAA′.

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com
SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique