Accéder au contenu
Merck
Toutes les photos(4)

Key Documents

HPA044948

Sigma-Aldrich

Anti-MIIP antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Flj12438, Anti-Iip45, Anti-Migration and invasion inhibitory protein

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Séquence immunogène

SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MIIP(60672)

Description générale

Migration and invasion inhibitory protein (MIIP), also called insulin-like growth factor binding protein 2 (IGFBP2), is expressed in fetal tissues and astroglial cells. It has an insulin-like growth factor (IGF) binding motif. It is a tumor-suppressor gene and is mapped to human chromosome 1p36.22. It has a C-terminal polyproline domain.

Immunogène

migration and invasion inhibitory protein recombinant protein epitope signature tag (PrEST)

Application

Anti-MIIP antibody produced in rabbit has been used in western blotting and in immunoprecipitation detection of MIIP in colorectal cancer cells.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Actions biochimiques/physiologiques

Migration and invasion inhibitory protein (MIIP), binds to insulin-like growth factor (IGF) and modulates cancer progression. It is under expressed in brain tumor, invasive glioblastoma multiforme. MIIP is a tumor suppressor gene and inhibits rat sarcoma (Ras)-related C3 botulinum toxin substrate 1- guanosine triphosphate (Rac1-GTP) mediated cell migration in endometrial carcinoma. Single nucleotide polymorphism in MIIP is associated with increased risk of breast cancer. MIIP inhibits non-small cell lung cancer progression by lowering epidermal growth factor receptor (EGFR) expression. Haploinsufficiency of MIIP is implicated in the colorectal tumor progression.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST76605

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

IIp45, an insulin-like growth factor binding protein 2 (IGFBP-2) binding protein, antagonizes IGFBP-2 stimulation of glioma cell invasion
Song SW, et al.
Proceedings of the National Academy of Sciences of the USA, 100(24), 13970-13975 (2003)
PRP4 kinase induces actin rearrangement and epithelial-mesenchymal transition through modulation of the actin-binding protein cofilin
Islam SU, et al.
Experimental Cell Research, 369(1), 158-165 (2018)
Yan Sun et al.
The Journal of pathology, 241(1), 67-79 (2016-10-16)
The gene encoding migration and invasion inhibitory protein (MIIP), located on 1p36.22, is a potential tumour suppressor gene in glioma. In this study, we aimed to explore the role and mechanism of action of MIIP in colorectal cancer (CRC). MIIP
MIIP remodels Rac1-mediated cytoskeleton structure in suppression of endometrial cancer metastasis
Wang Y, et al.
Journal of Hematology & Oncology, 9(1), 112-112 (2016)
MIIP accelerates epidermal growth factor receptor protein turnover and attenuates proliferation in non-small cell lung cancer
Wen J, et al.
Oncotarget, 7(8), 9118-9134 (2016)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique