HPA035526

Anti-FYCO1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-FLJ13335, Anti-FYVE and coiled-coil domain containing 1, Anti-ZFYVE7
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA035526

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: IQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFS
• Numéro d'accès UniProt: Q9BQS8
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FYCO1(79443)

Description

Description générale

FYVE and coiled-coil domain containing 1 (FYCO1) codes for a protein with 1478 amino acids. It has 18 exons and is of 79 kb in length. FYCO1 has a long central coiled-coil region flanked at the N terminus by an α-helical RUN domain or a zinc finger domain and at the C terminus by a FYVE domain. It is abundantly expressed in heart and skeletal muscle, skin, adipose tissue and the ovary. FYCO1 is a member of the emerging group of autophagic adaptor proteins. FYCO1 is located on human chromosome 3p21.31.

Immunogène

FYVE and coiled-coil domain containing 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-FYCO1 antibody has been used in immunostaining.

Actions biochimiques/physiologiques

FYVE and coiled-coil domain containing 1 (FYCO1) helps in the movement of autophagosomes along microtubules through its association with LC3. Mutations in FYCO1 results in autosomal-recessive congenital cataracts. FYCO1 participates in the progression of lens and transparency in humans.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST79454

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable