HPA023882
Anti-FAT1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-Cadherin-related tumor suppressor homolog, Anti-Protein fat homolog, Anti-Protocadherin Fat 1
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Technique(s)
immunohistochemistry: 1:50- 1:200
Séquence immunogène
NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... FAT1(2195)
Description générale
FAT atypical cadherin 1 (FAT1) protein is encoded by a gene mapped to human chromosome 4q34-35. The protein has ubiquitous expression in mammalian tissues, especially higher in kidney glomerular epithelial cells. FAT1 is localized to the leading edge of lamellipodia, filopodia, and microspike tips of cells. The protein is found to be abnormally expressed in pediatric patients with acute leukemia.
The encoded protein is characterized with cytoplasmic domain that is involved in assembly of components necessary to promote ectopic actin polymerization.
The encoded protein is characterized with cytoplasmic domain that is involved in assembly of components necessary to promote ectopic actin polymerization.
Immunogène
Protocadherin Fat 1 Precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-FAT1 antibody produced in rabbit has been used for western blotting. FAT1 antibody produced in rabbit has been used in immunofluorescence, tissue microarrays (TMAs) and immunohistochemistry (IHC).
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Actions biochimiques/physiologiques
FAT atypical cadherin 1 (FAT1) acts as a proximal element of cell migration signaling pathways.FAT1 interacts with Ena/Vasodilator-stimulated phosphoprotein (VASP) at the leading edges of lamellipodia, filopodia, and microspike tips and helps in normal actin dynamics and cell polarization. FAT1, with or without β-catenin, might function as a novel biomarker for breast cancer. Mutation of FAT1 gene leads to T-cell acute lymphoblastic leukemia (T-ALL) in adults. In humans, FAT1 might act both as an oncogene and a tumor suppressor. The protein modulates oncogenic pathways in glioma cell lines. FAT1 also act as a co-activator of hypoxia and growth receptor signaling to critical tumorigenic pathways in hepatocellular carcinoma (HCC).
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST85143
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Podocyte proteins in congenital and minimal change nephrotic syndrome.
Suvanto M, et al.
Clinical and Experimental Nephrology, 19(3), 481-488 (2015)
Loss of FAT1 during the progression from DCIS to IDC and predict poor clinical outcome in breast cancer.
26721716
26721716
Wang L
Experimental and Molecular Pathology, 100(1), 177-183 (2016)
FAT1 expression and mutations in adult acute lymphoblastic leukemia.
Neumann M
Blood Cancer Journal, 4 (2014)
Michael P Weekes et al.
Cell, 157(6), 1460-1472 (2014-06-07)
A systematic quantitative analysis of temporal changes in host and viral proteins throughout the course of a productive infection could provide dynamic insights into virus-host interaction. We developed a proteomic technique called "quantitative temporal viromics" (QTV), which employs multiplexed tandem-mass-tag-based
De-Chen Lin et al.
Nature genetics, 46(8), 866-871 (2014-06-24)
Nasopharyngeal carcinoma (NPC) has extremely skewed ethnic and geographic distributions, is poorly understood at the genetic level and is in need of effective therapeutic approaches. Here we determined the mutational landscape of 128 cases with NPC using whole-exome and targeted
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique