HPA015520

Anti-NEK7 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-NimA-related protein kinase 7, Anti-Serine/threonine-protein kinase Nek7
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA015520
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunohistochemistry: 1:20- 1:50
• Séquence immunogène: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVAL
• Numéro d'accès UniProt: Q8TDX7
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NEK7(140609)

Description

Description générale

NEK7 (NIMA (never in mitosis A)-related kinase 7) belongs to the family of NIMA-related serine/threonine kinases. This family consists of eleven members from NEK1 to NEK11. It has a conserved catalytic domain at its N-terminal, and a non-conserved regulatory domain at its C-terminal. This protein is a resident of centrosomes. This protein is composed of 303 amino acid residues. This protein, along with NEK6, is the smallest member of this family.

Immunogène

Serine/threonine-protein kinase Nek7 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

NEK7 (NIMA (never in mitosis A)-related kinase 7) is involved in the control of mitosis, by forming a mitotic kinase cascade, which includes NEK6 and NEK9. It has an essential role in the formation of spindle fibers during mitosis, as well as is involved in cytokinesis. During interphase, it is essential for the duplication of centrosome, and the recruitment of centrosomal pericentriolar materials (PCM). It is involved in regulating the stability of microtubules (MT), and phosphorylates MT-related proteins or MT motors. It also phosphorylates Eg5, which is a kinesin motor protein, and is essential for the formation of mitotic spindle. Studies also suggest that it may play a role in various cancers, and this might be attributable to its ability to regulate MT dynamics.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73507

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)